Protein Info for HSERO_RS23260 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 72 (27 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 147 to 176 (30 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 246 to 271 (26 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 29 to 294 (266 residues), 153 bits, see alignment E=4.5e-49

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to hse:Hsero_4651)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXZ5 at UniProt or InterPro

Protein Sequence (334 amino acids)

>HSERO_RS23260 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MKQIAHFRYTLLAAAVALLLPLLLPSGTLATEVLVFALAALGCNLLLGYTGLMSFGQGIF
FGVGSYTAGVVLLQLKLALLPALALAALGGALVALLVGWFSIRQRGTYFVMLTLAFAQMF
YFLAYTMKDVTGGDNGLLDIPRPPLALFGLTLLPTTSSWQYYTVVAILFVLVFWLLQRVV
DSVLGKTLLAVRENEARASALGYDVRLLKLAAFVISGAVTGLAGGLHAMMTGVAPLSNIE
YHTSEAILVMTVIGGTGNLFASVLGASFYVLVGNWLSTLWPRWLMLLGLLLIAVSLYMQK
GLFGLAMKIIDAVRGNKGASAQAATATATKEKHS