Protein Info for HSERO_RS22880 in Herbaspirillum seropedicae SmR1

Annotation: NUDIX hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00293: NUDIX" amino acids 10 to 126 (117 residues), 28.3 bits, see alignment E=1.6e-10 PF19368: AraR_C" amino acids 141 to 209 (69 residues), 28.2 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4579)

Predicted SEED Role

"Nudix-related transcriptional regulator NrtR" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IX08 at UniProt or InterPro

Protein Sequence (221 amino acids)

>HSERO_RS22880 NUDIX hydrolase (Herbaspirillum seropedicae SmR1)
MDPVICTVDVVLLTLTAEGLEVALLKREHAPFKGVAALPGGYIHARTDTDARDAARRVLL
DKTGIAAPYLEQLATFSGAARDPRGWSVSIAYYALVPAATIAQAERHEVRLYSVDRLPPL
PFDHGDIIETAVSRLRSKSQYSSLPCHLLGEVFTLPQLQRVYEVLMGESINKVSFRRKMT
EMDMLDPVDGQFDSSGAHRPAQLYRLKPAFREQLQLLERGL