Protein Info for HSERO_RS22705 in Herbaspirillum seropedicae SmR1
Annotation: heme oxygenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to PIGA_PSEAE: Heme oxygenase PigA (pigA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K07215, heme oxygenase (inferred from 100% identity to hse:Hsero_4544)MetaCyc: 48% identical to heme oxygenase (biliverdine-IX-beta and delta-producing) (Pseudomonas aeruginosa)
RXN-18338 [EC: 1.14.99.58]; 1.14.99.58 [EC: 1.14.99.58]
Predicted SEED Role
"Heme oxygenase HemO, associated with heme uptake" in subsystem Heme, hemin uptake and utilization systems in GramPositives or Hemin transport system or Oxidative stress
MetaCyc Pathways
- heme degradation III (2/2 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.14.99.58
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See D8IWX3 at UniProt or InterPro
Protein Sequence (196 amino acids)
>HSERO_RS22705 heme oxygenase (Herbaspirillum seropedicae SmR1) MKPVATPAPSLSARLKADTAALHEQMHALMEQAQPFADRARYAQFVAAQYHFQRDVEHLF DDPALQAAVPDLQVRGREADALADLADLGAVPGQIDIATATVRMPEALGWLYVSEGSTLG AAFLLKQVQQRLGLDEQFGARNLAAYAEGRAVVWRRFVGFLDQAGDSPQVQEAVLAGARA AFERFGALLRRHFALA