Protein Info for HSERO_RS22705 in Herbaspirillum seropedicae SmR1

Annotation: heme oxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01126: Heme_oxygenase
  • amino acids 10 to 190 (181 residues), 82.9 bits, E=1.5e-27

Best Hits

Swiss-Prot: 48% identical to PIGA_PSEAE: Heme oxygenase PigA (pigA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07215, heme oxygenase (inferred from 100% identity to hse:Hsero_4544)

MetaCyc: 48% identical to heme oxygenase (biliverdine-IX-beta and delta-producing) (Pseudomonas aeruginosa)
RXN-18338 [EC: 1.14.99.58]; 1.14.99.58 [EC: 1.14.99.58]

Predicted SEED Role

"Heme oxygenase HemO, associated with heme uptake" in subsystem Heme, hemin uptake and utilization systems in GramPositives or Hemin transport system or Oxidative stress

MetaCyc Pathways

• heme degradation III (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.99.58

Sequence Analysis Tools

See D8IWX3 at UniProt or InterPro

Protein Sequence (196 amino acids)

>HSERO_RS22705 heme oxygenase (Herbaspirillum seropedicae SmR1)
MKPVATPAPSLSARLKADTAALHEQMHALMEQAQPFADRARYAQFVAAQYHFQRDVEHLF
DDPALQAAVPDLQVRGREADALADLADLGAVPGQIDIATATVRMPEALGWLYVSEGSTLG
AAFLLKQVQQRLGLDEQFGARNLAAYAEGRAVVWRRFVGFLDQAGDSPQVQEAVLAGARA
AFERFGALLRRHFALA