Protein Info for HSERO_RS22685 in Herbaspirillum seropedicae SmR1

Annotation: allantoate amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 15 to 413 (399 residues), 337.9 bits, see alignment E=4.2e-105 PF01546: Peptidase_M20" amino acids 86 to 414 (329 residues), 71.7 bits, see alignment E=8.5e-24 PF07687: M20_dimer" amino acids 217 to 318 (102 residues), 23.7 bits, see alignment E=4e-09

Best Hits

KEGG orthology group: K06016, N-carbamoyl-L-amino-acid hydrolase [EC: 3.5.1.87] (inferred from 100% identity to hse:Hsero_4540)

Predicted SEED Role

"N-carbamoyl-L-amino acid hydrolase (EC 3.5.1.87)" in subsystem Hydantoin metabolism (EC 3.5.1.87)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.87

Use Curated BLAST to search for 3.5.1.87

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWW9 at UniProt or InterPro

Protein Sequence (417 amino acids)

>HSERO_RS22685 allantoate amidohydrolase (Herbaspirillum seropedicae SmR1)
MKAVPEPFQQAGRQAMQWAQQLAQHTESPGMLTRTYLTPQHQAAAAALARWMEEAGMRVR
RDNAGNVIGRYEAAPGHESAPSFVTGSHFDTVRNGGWYDGNLGIVLPLACIARWHRQGQR
FAFPIEVIGFAEEEGVRFKATLLGSRTVAGTFDQAVLENRDSDGVTMRAAIRAAGLDPDG
IAADAWQPGSMAAFVEVHIEQGPLLLNEDLPVGVVTAISGASRFMAEVHGLAGHAGTVPM
HLRRDAAMAAAEIGLYIERRCSIKPELVGTMGLLEVVQGAANVVPGLASFSIDIRAEDDS
DRLAAVADVKAEIDRIAARRQVQLALRQTHEAASVPCAPRLQAALAQSIAAAGWPVRHLP
SGAGHDAMALAGLADVAMLFVRCGNGGISHHPDETMTEADAAIAAQVFSHLVEQFQP