Protein Info for HSERO_RS22255 in Herbaspirillum seropedicae SmR1

Annotation: 3-phosphoglycerate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF00389: 2-Hacid_dh" amino acids 13 to 306 (294 residues), 73.5 bits, see alignment E=1.4e-24 PF02826: 2-Hacid_dh_C" amino acids 113 to 284 (172 residues), 213.7 bits, see alignment E=1.3e-67

Best Hits

Swiss-Prot: 37% identical to GHRB_YERP3: Glyoxylate/hydroxypyruvate reductase B (ghrB) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K00058, D-3-phosphoglycerate dehydrogenase [EC: 1.1.1.95] (inferred from 100% identity to hse:Hsero_4453)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVW1 at UniProt or InterPro

Protein Sequence (308 amino acids)

>HSERO_RS22255 3-phosphoglycerate dehydrogenase (Herbaspirillum seropedicae SmR1)
VSAAKKEVVIVTGVDLAQAAVELLRDYELVYAGAKPTEDDMVKLAQLHQPVAIIVRYGGV
SARVMDAAPILRVISKHGTGIDSIDSQAAQQRGIAVKAAAGANAPAVAEHTWALIMACAK
NVVGLDQRMREGHWDKSTHKSLELQGRTLGLVGLGAIGRRVAAVAAALGMPVLAHDPYAK
EAPQGVQLVDLDTLFAQSDVVSLHCPLTAENKHMINAQSLARMKDGAILVNTARGGLIDE
QALIAALDSGKLRAAGLDSFEKEPFTAPHPLQRVGNAVLSPHIGGVTSDAYIAMGTGAAS
NVLAVLGA