Protein Info for HSERO_RS22165 in Herbaspirillum seropedicae SmR1

Annotation: cytochrome C peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 98 to 398 (301 residues), 165.8 bits, see alignment E=5.9e-53 PF16576: HlyD_D23" amino acids 104 to 335 (232 residues), 131.3 bits, see alignment E=6.5e-42 PF13533: Biotin_lipoyl_2" amino acids 124 to 160 (37 residues), 29.6 bits, see alignment 9.1e-11 PF13437: HlyD_3" amino acids 233 to 332 (100 residues), 62.7 bits, see alignment E=9.6e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4435)

MetaCyc: 54% identical to cobalt-zinc-cadmium resistance protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVU3 at UniProt or InterPro

Protein Sequence (420 amino acids)

>HSERO_RS22165 cytochrome C peroxidase (Herbaspirillum seropedicae SmR1)
MTRKQKFAIAAIIAIAAILSGISLMQAGTPAGAEKSPAHQEEGGHKDNEHHGEEKGSEHK
DAAEHGEGEHHDAEPSSEEGKIALNPEQIATAGIEVKTAGPMILNSSVQLPGEIRFNEDR
TAHVVPQVAGIVESVSAKLGQKVRKGQVLAVINSSAVSEQRSEMLNAEQRLALARTAYQR
EKQLWEQKISAEQDYLQAQAALREAEVAVRNAQQKLRAIGATASSGGLNRYEIRAPFDGV
VVEKHLGLGEAVKEDANAFLISDLSSVWAEIIVSPKDMQFVRTGEKVTVRATAFDASASG
KISYVGSLIGEQSRTAKAHVILPNPDDSWRPGLFVNVEVVSDEAQVPVAVSAEALQTVEE
KSVIFVRVPGGFAAQQVVTGRSNGKFVEIRSGLNAGDEYAATGSFAIKAELGKGSAEHSH