Protein Info for HSERO_RS22000 in Herbaspirillum seropedicae SmR1

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 8 to 127 (120 residues), 37.4 bits, E=5e-13
• PF00106: adh_short
  • amino acids 9 to 190 (182 residues), 107.5 bits, E=1.3e-34
• PF01370: Epimerase
  • amino acids 10 to 86 (77 residues), 22.1 bits, E=1.8e-08
• PF13561: adh_short_C2
  • amino acids 14 to 242 (229 residues), 118.2 bits, E=9e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4399)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of chorismate metabolism (43/59 steps found)

Sequence Analysis Tools

See D8IVQ8 at UniProt or InterPro

Protein Sequence (255 amino acids)

>HSERO_RS22000 short-chain dehydrogenase (Herbaspirillum seropedicae SmR1)
MTSPSSAGIALVTGAARRIGRHIALALAQSGWDVAVHYNRSREEADTLVREIETLGRRAL
AVQAELGDETQVRSLLPQAAPLGRISCVVNNASLFDYDDAASFGNERLLRHMSANVGAPV
LLAQALYEATPQGQQAVVINLLDQKLYNPNPDFLSYTLSKAALHSATTLLAQALAPKVRV
VGVAPGLTMVSGDQTEEQFGKAHQVTPLGRGSTPEDIAAAVCYVASARAVTGTTLLVDGG
QHLLPLSRDVMFVAK