Protein Info for HSERO_RS21775 in Herbaspirillum seropedicae SmR1

Annotation: primosome assembly protein PriA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 PF17764: PriA_3primeBD" amino acids 7 to 106 (100 residues), 78.6 bits, see alignment E=7.7e-26 PF04851: ResIII" amino acids 170 to 336 (167 residues), 44.7 bits, see alignment E=4.3e-15 PF00270: DEAD" amino acids 173 to 340 (168 residues), 66.1 bits, see alignment E=1e-21 TIGR00595: primosomal protein N'" amino acids 191 to 706 (516 residues), 548 bits, see alignment E=9.9e-169 PF18319: PriA_CRR" amino acids 423 to 445 (23 residues), 33 bits, see alignment (E = 1.4e-11) PF00271: Helicase_C" amino acids 484 to 567 (84 residues), 27.6 bits, see alignment E=8.8e-10 PF18074: PriA_C" amino acids 615 to 705 (91 residues), 64.2 bits, see alignment E=4.8e-21

Best Hits

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 100% identity to hse:Hsero_4356)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVL6 at UniProt or InterPro

Protein Sequence (708 amino acids)

>HSERO_RS21775 primosome assembly protein PriA (Herbaspirillum seropedicae SmR1)
VEQRILQVALDTPLHTVFDYAWQAQAEGELVPAIGQLVVVPFGRREAVGVVVGHVSQSAL
EQGKIKQVIAVRHQLPPLSAHWLALCGFAADYYQRPLGEVMLPGLPKNLRALSTVALDKA
LNALGRLSAPKKSKARSKARAHPEDEARQETAAADATPADPMQFAQAPALNAAQQEAADA
IAAAHAFAPLLLYGVTGSGKTEVYLQAAAAILRRAAESGERAQILVLVPEINLTPQLEGN
IRARFPHLNVVALHSGLAEGERARNWLAAHLGQAQIVLGTRLAILASLPALKLIVIDEEH
DPSYKQQEGLRYSARDLAVWRAHQLGIPVVLGSATPSLETWQHAQAGRYRRLELRQRAAR
EAVLPTVKVIDLERDKPVDGLTATLIAAVRKRLEQGEQSLLFLNRRGYAPVLACDACGWI
SNCMRCDAFMVVHRPERRLRCHHCSLELHIPRACPTCGNVDLQPLGRGTQRVEEGLQAIF
PEARVLRIDADSTRLKGSAQSAFDSVHRGEVDILIGTQMVAKGHDFKKLTLVGVLNPDTA
LFSHDYRASERLFAQLMQVAGRAGRAGLSADGSSGEVLIQTRYPHHPLYQAVIRHDYDGF
AGELLEERRQAHFPPFMYQALLRAEARELDTAMAFLKDAATLLEAPAITINEPIPMTLMR
VANVERAQLLIECASRPVLQAFLKQWLALLRQVKTRARWSLEVDPVDI