Protein Info for HSERO_RS21750 in Herbaspirillum seropedicae SmR1

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR00460: methionyl-tRNA formyltransferase" amino acids 1 to 309 (309 residues), 311 bits, see alignment E=4.1e-97 PF00551: Formyl_trans_N" amino acids 1 to 187 (187 residues), 152.2 bits, see alignment E=1.3e-48 PF02911: Formyl_trans_C" amino acids 211 to 309 (99 residues), 95 bits, see alignment E=2.7e-31

Best Hits

Swiss-Prot: 76% identical to FMT_HERAR: Methionyl-tRNA formyltransferase (fmt) from Herminiimonas arsenicoxydans

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 100% identity to hse:Hsero_4351)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.9

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVL1 at UniProt or InterPro

Protein Sequence (317 amino acids)

>HSERO_RS21750 methionyl-tRNA formyltransferase (Herbaspirillum seropedicae SmR1)
MKIIFAGTPEFAAVALEALYAAGHEITLVLTQPDRPAGRGMQLQASPVKQCALKHGTPVA
QPVSLRLDGKYPEVAQEAHALLRSTPHDVMIVAAYGLILPRSVLDIPRYGCINIHGSLLP
RWRGAAPIHRAIEAGDAETGITIMQMEEGLDTGPMMLIESLPISDEDTTGSLHDKLAALG
AKMIVEAMEKLEQGTLPATPQPEQGANYAAKIAKEEAALDFSQSAEQLARRIRAFNPFPG
ATGRFGDTVVKLWKARAVTVAQQGEPGQVLSADAQGGIVVACGEGALLLTELQKPGGKRL
PAAEFLKGFPMEGGRLA