Protein Info for HSERO_RS21580 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details TIGR00698: conserved hypothetical protein" amino acids 14 to 341 (328 residues), 381.8 bits, see alignment E=1.6e-118 PF03601: Cons_hypoth698" amino acids 16 to 325 (310 residues), 343.1 bits, see alignment E=5.8e-107

Best Hits

Swiss-Prot: 62% identical to Y5383_PSEAE: UPF0324 membrane protein PA5383 (PA5383) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4318)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUQ5 at UniProt or InterPro

Protein Sequence (349 amino acids)

>HSERO_RS21580 membrane protein (Herbaspirillum seropedicae SmR1)
MRTATQTSPLHPALAGLALSGALAWAAMSLGNIGWLQDHGFSALTVAIVLGIVLGNTIYP
RLGASCGEGVRFSKQTLLRAGIILYGFRLTFQDIAHVGLAGVVIDAAMLLSTFGLAWLVG
TKVLKLDRDAALLIGAGSSICGAAAVMATEPVLRARSEQVTVAVSTVVIFGSLAIFLYPL
LHTLQAEPAWGLRLPDFGVYIGSTVHEVAQVLAAARSIDQHTADVAVITKMVRVMMLAPF
LLMLSMKAAPTTSGHQHQHNKLSIPWFAFAFIGVVVFNSFFPLPAALNQLLLQADTLMLA
MAMAALGLSTHLSALRSAGIKPMILGAVLFAWLVVGGALVNGALGRLLA