Protein Info for HSERO_RS21375 in Herbaspirillum seropedicae SmR1

Annotation: N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF17827: PrmC_N" amino acids 15 to 75 (61 residues), 59.6 bits, see alignment E=1.9e-19 TIGR00536: methyltransferase, HemK family" amino acids 23 to 272 (250 residues), 248.7 bits, see alignment E=6.2e-78 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 27 to 272 (246 residues), 301.3 bits, see alignment E=5.5e-94 PF05175: MTS" amino acids 98 to 191 (94 residues), 64.9 bits, see alignment E=3.7e-21 PF06325: PrmA" amino acids 105 to 184 (80 residues), 36 bits, see alignment E=2.9e-12 PF13847: Methyltransf_31" amino acids 112 to 241 (130 residues), 48.5 bits, see alignment E=4.2e-16 PF08242: Methyltransf_12" amino acids 115 to 184 (70 residues), 31.8 bits, see alignment E=9.9e-11 PF13649: Methyltransf_25" amino acids 115 to 184 (70 residues), 47.7 bits, see alignment E=1.1e-15 PF08241: Methyltransf_11" amino acids 115 to 184 (70 residues), 33 bits, see alignment E=3.9e-11 PF01170: UPF0020" amino acids 127 to 189 (63 residues), 25.5 bits, see alignment E=4.9e-09

Best Hits

Swiss-Prot: 55% identical to PRMC_BORPE: Release factor glutamine methyltransferase (prmC) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to hse:Hsero_4277)

MetaCyc: 48% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUL4 at UniProt or InterPro

Protein Sequence (277 amino acids)

>HSERO_RS21375 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase (Herbaspirillum seropedicae SmR1)
MPILPSYAGCTLATVLKTAPLDPLENRILLCHALRLTRVQLITQSERQLSAAEAETLAAL
LARRLRGEPIAYIVGQREFYGLDLRVSPDVLIPRPDTELLVELALERLPQGGSALDMGTG
SGAIAVAIAHTRPDAQVTALDASPAALAIARENASTHQVRVRLLESDWYGALDADQAFDL
IVSNPPYIVAGDIHLSQGDLRFEPVDALTDHADGLSDLRTIIEGAPAHLKAGGWLLMEHG
YDQAAAVRALLTGGGWREVQSWRDLAGIERVSGARLG