Protein Info for HSERO_RS21365 in Herbaspirillum seropedicae SmR1

Annotation: peptide chain release factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR00019: peptide chain release factor 1" amino acids 2 to 352 (351 residues), 540.6 bits, see alignment E=7.6e-167 PF03462: PCRF" amino acids 9 to 199 (191 residues), 249.8 bits, see alignment E=2e-78 PF00472: RF-1" amino acids 210 to 317 (108 residues), 154.6 bits, see alignment E=1e-49

Best Hits

Swiss-Prot: 86% identical to RF1_JANMA: Peptide chain release factor 1 (prfA) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K02835, peptide chain release factor 1 (inferred from 100% identity to hse:Hsero_4275)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUL2 at UniProt or InterPro

Protein Sequence (355 amino acids)

>HSERO_RS21365 peptide chain release factor 1 (Herbaspirillum seropedicae SmR1)
MLAKLDQLAERLEELNSLLAQEDATASMDNFRKMTREHAELGPLVALYHEYVQAAEDIRT
AQELLADPDMKAFAQEEIDGAKARMEGLELDLQKMLLPKDPNDERNIFLEIRAGTGGDES
ALFAGDLLRMYTRYAERQRWQVEIVSASESELGGYKEVIARIVGLGAYSRLKFESGGHRV
QRVPATETQGRIHTSACTVAVMPEADEVGDVEINPADIRIDTYRASGAGGQHINKTDSAV
RITHLPTGIVVECQDDRSQHKNKAQAMKVLAARIKDVQLRQQQSEEAATRKSLIGSGDRS
ERIRTYNFPQGRMTDHRINLTLYKLDFIMDGDLDELTNALITEHQAELLAQLGDD