Protein Info for HSERO_RS20955 in Herbaspirillum seropedicae SmR1

Annotation: thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF10411: DsbC_N" amino acids 47 to 99 (53 residues), 65 bits, see alignment E=3.3e-22 PF13098: Thioredoxin_2" amino acids 128 to 251 (124 residues), 97.5 bits, see alignment E=5.6e-32

Best Hits

KEGG orthology group: K03981, thiol:disulfide interchange protein DsbC [EC: 5.3.4.1] (inferred from 100% identity to hse:Hsero_4189)

Predicted SEED Role

"Thiol:disulfide interchange protein DsbC" in subsystem Periplasmic disulfide interchange

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITM9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>HSERO_RS20955 thiol:disulfide interchange protein (Herbaspirillum seropedicae SmR1)
MKNFLTAGASSLRHLSMAALLLASTVVGVSAHAQAEAAESTEATIKKLIEPRLGKDAKVD
AVTKTPYAGLYEIQIDGDVIYTDAKAQYLFIGRVVDSQTYRDYTKEKIESLNQIPFSGLP
LDKAIKTVKGNGKRVIAIFEDPNCIYCKRLHKTLQEVDNITYYTFQYNILSPDSIVKSRN
IWCAPNPSRAWSEWMVNGKEAPAAATSCNAPHEDVLALGQKLKVTGTPTIFFTDGSRIPG
AVDAKSLEQKLSSLK