Protein Info for HSERO_RS20805 in Herbaspirillum seropedicae SmR1

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF13489: Methyltransf_23" amino acids 47 to 219 (173 residues), 34.1 bits, see alignment E=5.4e-12 PF13649: Methyltransf_25" amino acids 59 to 173 (115 residues), 48.9 bits, see alignment E=2.2e-16 PF08241: Methyltransf_11" amino acids 60 to 177 (118 residues), 67.1 bits, see alignment E=4.4e-22 PF08242: Methyltransf_12" amino acids 60 to 175 (116 residues), 36.5 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 43% identical to BIOC_NITMU: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 100% identity to hse:Hsero_4163)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITK3 at UniProt or InterPro

Protein Sequence (314 amino acids)

>HSERO_RS20805 methyltransferase (Herbaspirillum seropedicae SmR1)
MSLPPPSASAKLSAPIDLPLVRRRFAHPQRVAESDFLRREVSARMQERLALVKIHPREVL
DAGCGEGADLPVLQKRYPEAQVVGLDGAYGMLAVAAEHQRGAQSAMNRLFGSINKWLGSG
PALSGPELACADFARLPLAANALDLVWSNLALHWHPQPDRVFAEWRRVLRVEGLLMFSCF
GPDTLREVRSAFERIDLAPHTLPFVDMHDFGDMLVNAGFSTPVMDMETITVTYDTPQRLL
EDVRAWGGNPLETRRRSMMSRDQYQRLLAAFEAMRKPDGKIPLTFEIIYGHAFRPVPKTT
AAGESIIRFDRPPR