Protein Info for HSERO_RS20750 in Herbaspirillum seropedicae SmR1

Annotation: cytochrome C oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 36 to 351 (316 residues), 271.5 bits, see alignment E=4.4e-85

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to hse:Hsero_4153)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITJ3 at UniProt or InterPro

Protein Sequence (378 amino acids)

>HSERO_RS20750 cytochrome C oxidase subunit I (Herbaspirillum seropedicae SmR1)
MTATMLIQLGLTGLVVALIPLAVVWRAQGAANKYRKLVWVTLFFTFDLIMFGAFTRLTDS
GLGCPDWPGCYSHANPLLAHEHINAAQEAMPTGPVTWAKAWIEMTHRYFAMAVGFLIIVL
MVAAWWRWIRSGKTELQFRPWFPTALLGFVCLQGAFGAWTVTMKLQPIIVTLHLLLGLNL
LAMLTWLAARQEPHLPVSPAGRALIVPATLGAALLGLQIALGGWVSTNYAALACTDFPLC
DGKLVPDMDFAHGFTLWRHLGMTSGGDYLPFQALTAIHWVHRSFAFVVILYVVWLAHRAL
REEGLRKTGRWLLTVLGLQLCTGLATIYLNWPLAIAVVHNGGAALLVILMVMLNYKVRYA
PSGQAIAAPPATARPVTP