Protein Info for HSERO_RS20720 in Herbaspirillum seropedicae SmR1
Annotation: GMP synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to FTSE_ECO57: Cell division ATP-binding protein FtsE (ftsE) from Escherichia coli O157:H7
KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 100% identity to hse:Hsero_4147)MetaCyc: 42% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]
Predicted SEED Role
"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)
Isozymes
No predicted isozymesUse Curated BLAST to search for 7.4.2.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See D8ITI7 at UniProt or InterPro
Protein Sequence (230 amino acids)
>HSERO_RS20720 GMP synthase (Herbaspirillum seropedicae SmR1) MIEFTRVSKQYAREVYALRDITLSVRKGELIFLAGPSGAGKSTLLKMIAAIERPTAGKLA VNGTDIGGLKASGLPYLRRNLGLIFQQQKLLLDRNLLSNVMLPLIVTGSSRQDAERRARA ALDKVDLLGKAMCEPMELSGGEQQRVAIARAIVNRPQIILADEPTANLDRANANKVLAAL KSFHGVGVTCLISTHDEQFLTGADRIIYLDRGRIVDGWHNGVANPVEVSP