Protein Info for HSERO_RS20675 in Herbaspirillum seropedicae SmR1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF04340: DUF484" amino acids 13 to 188 (176 residues), 29.3 bits, see alignment E=1e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 197 to 369 (173 residues), 180.6 bits, see alignment E=1e-57 PF00990: GGDEF" amino acids 202 to 365 (164 residues), 164.4 bits, see alignment E=2.9e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4138)

Predicted SEED Role

"hypothetical protein. Putative conserved domain: IPR000160 diguanylate cyclase (GGDEF) domain)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITH8 at UniProt or InterPro

Protein Sequence (372 amino acids)

>HSERO_RS20675 diguanylate cyclase (Herbaspirillum seropedicae SmR1)
MRSAIDSEALIADNEQLRAELQDLLQQAHINQSIIERHQAFDLKLIGASEFRELIEVMLT
VMPGVFSLETVTLSLIDGDYAIQRILRDLQIGINEFPKLLFLKQALAFPDDDLTRADEKP
RLGPYVAALHGPLFPHYEPVSVAVLPLVRQHRLLGYLALGSAYGERFTRSLATDFIERLA
TIAAVCLENVINNERLKHIGLTDPLTGVNNRRYIEQRMQEEVARSQRDRSALSCLFIDID
HFKRVNDQFGHQSGDDVLREVAARIKKELRLSDALGRFGGEEFVVLLTHATREDAARIAE
RIRAGVCSRGVMIEGSRDPLKITASIGAAALTPPDRSRPAAEVKQAMLKAADQALYQAKE
AGRNRVMLAAGD