Protein Info for HSERO_RS20520 in Herbaspirillum seropedicae SmR1

Annotation: hexuronate transporter ExuT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details amino acids 266 to 289 (24 residues), see Phobius details amino acids 298 to 322 (25 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 312 (298 residues), 170.2 bits, see alignment E=6.1e-54 amino acids 304 to 419 (116 residues), 34 bits, see alignment E=1.6e-12 PF00083: Sugar_tr" amino acids 44 to 189 (146 residues), 24 bits, see alignment E=1.7e-09

Best Hits

Swiss-Prot: 52% identical to EXUT_ECO57: Hexuronate transporter (exuT) from Escherichia coli O157:H7

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to hse:Hsero_4107)

MetaCyc: 52% identical to hexuronate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-123; TRANS-RXN-35

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITE7 at UniProt or InterPro

Protein Sequence (428 amino acids)

>HSERO_RS20520 hexuronate transporter ExuT (Herbaspirillum seropedicae SmR1)
LKTIKGLRWWIIVLVCLGTITNYLARNSLGVLAPTLKDELGMSTQQYSYVVAAFQVGYTI
MQPVCGFIVDLIGLRIGFALFGVLWSVAGVLHAGATGWLSLAGFRALMGLTEAAAIPSGM
KAVAEWFPDKEKSVAVGWFNSGTSLGAMLAPPLVIFLQIRYGWQSAFVVTGILGFVWAAL
WFAFYRSPRDHAALSDSERETIISGQLRPVSAVRGKRPVKDVVRSRRFWAIALARFFAEP
AWQTFSFWIPLYFVNERHLDLKSIAMFAWLPFLAADLGGLAGGYLSPFLINRFRIPLVWS
RVCGVVLGAVMMIGPACVGLVASPYVAIALFCVGGFAHQMISGLVNTLSADVFDPEEVGT
ASGFAGMSAWIGGLGFSLLVGALADTVGYGPLFGMLGAFDLIGAVLLIILIRGQSTEERA
ARSLQSSV