Protein Info for HSERO_RS20150 in Herbaspirillum seropedicae SmR1

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 889 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 12 to 877 (866 residues), 1257.6 bits, see alignment E=0 PF02861: Clp_N" amino acids 23 to 74 (52 residues), 32.7 bits, see alignment 3.1e-11 amino acids 111 to 125 (15 residues), 8 bits, see alignment (E = 0.0015) PF00004: AAA" amino acids 234 to 365 (132 residues), 39.6 bits, see alignment E=3.2e-13 amino acids 624 to 742 (119 residues), 28.7 bits, see alignment E=7.2e-10 PF17871: AAA_lid_9" amino acids 375 to 474 (100 residues), 98.9 bits, see alignment E=6.8e-32 PF07724: AAA_2" amino acids 618 to 787 (170 residues), 190.7 bits, see alignment E=9.1e-60 PF07728: AAA_5" amino acids 623 to 744 (122 residues), 39.7 bits, see alignment E=2.3e-13 PF10431: ClpB_D2-small" amino acids 798 to 867 (70 residues), 37.8 bits, see alignment 7.3e-13

Best Hits

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IST6 at UniProt or InterPro

Protein Sequence (889 amino acids)

>HSERO_RS20150 ATPase (Herbaspirillum seropedicae SmR1)
MGINLRSLICKLNETARLATERAATLCVSCSHYEVDLEHLFLALLEQPQSDFSLIARRSG
IDTDGLQADLEHEISTFREGNARTPVLSPHLRTLFENGWLIASLEESNPSVRSAHLLLAL
LTQSDLSQLAYRGSKLFAKFKIDEIKHNLHRLTEGSVESAAIGKTGQGGDRESGGDPMGE
LKQLRIGKMTALDQYTTQLTQRARDGKIDPVIGRDAEIRQAVDILLRRRQNNPILTGEAG
VGKTAVVEGLALRIAQGDVPKPLQGVEIHTLDMGLLQAGASVKGEFESRLKTVIDEVKKS
AYPIILFIDEAHTMIGAAGQAGQSDAANLLKPALARGELRTIAATTWSEYKKYFEKDAAL
ARRFQVIKVEEPGEDVACAMLRAMVPLMEQHFGVRVYDEAVVEAVRLSHRYISGRQLPDK
AISVLDTACAKVALGRDATPALLEGVTRRLERLDTEISALRREAASGSQHEERLASLLDQ
HVCAVAERHDLQLRWEQERELNERIQQARATLENPGTGDARGGNVDAARAELKQLLDELR
QRQGDAPMVPIQVDGHVVAEIVAAWTGIPLGKMVKDEIQTVLDLDALLQERVLGQPQATS
AVAQRVRTSRANLDDPGKPKGVFLFVGPSGVGKTETALALADVLYGGERKLITINMSEYQ
EAHTVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHADVLELFFQVFDKGV
MDDAEGREIDFKNTIIILTSNVASAQMMQACLNKSQEELPTPEELDTLIRPQLIKTFKPA
FLGRLKVVPYYPIADVVLVEIIKLKLARIAKRVAENHRVEFSYDKALVEAVLGRCTEVDS
GARNVDNILSGTLLPAVAESVLVRMAEGVEIRRIKVSASKKGDFKYTIQ