Protein Info for HSERO_RS20135 in Herbaspirillum seropedicae SmR1

Annotation: type VI secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 186 to 205 (20 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details PF09867: TagF_N" amino acids 11 to 142 (132 residues), 105.7 bits, see alignment E=9.4e-35 TIGR03373: type VI secretion-associated protein, BMA_A0400 family" amino acids 11 to 137 (127 residues), 102.4 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4028)

Predicted SEED Role

"FIG00977343: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IST3 at UniProt or InterPro

Protein Sequence (330 amino acids)

>HSERO_RS20135 type VI secretion protein (Herbaspirillum seropedicae SmR1)
MSATGTHIKIGYFGKIPARGDFIKATDQAALITLLDNWLAQAMELLSRDARWKIIYDGVK
PLHFVVMGPRSRRAVAGHLRASSDQSQRRFPFISMSAFDIDDPVAFVGNSPLILARLWSR
MESQIQEVLTTPDPGQSLQAMASTTVELDIDSNGYGYGAAFTDFLELHTTGSLQQMLADA
GFNGNLRQLLLALGLLLHPVMVSTSSRLDKNLILPLPHDTMYRGLVASFWMHLITPFLTR
ADFELSLFLTRMEEQPCMFLGFSGASPRTLHSVMDTVAGAEHNISFDDAEWVEEHVGGNY
GVQKLSSYLAHPELSLRSAIDSFHDAFTGA