Protein Info for HSERO_RS19990 in Herbaspirillum seropedicae SmR1

Annotation: acetyl-CoA acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR02430: 3-oxoadipyl-CoA thiolase" amino acids 2 to 400 (399 residues), 740.4 bits, see alignment E=5.1e-227 PF00108: Thiolase_N" amino acids 4 to 267 (264 residues), 255.1 bits, see alignment E=1.1e-79 TIGR01930: acetyl-CoA C-acyltransferase" amino acids 6 to 398 (393 residues), 446 bits, see alignment E=1.1e-137 PF00109: ketoacyl-synt" amino acids 89 to 123 (35 residues), 22.6 bits, see alignment 1.1e-08 PF02803: Thiolase_C" amino acids 275 to 399 (125 residues), 153.5 bits, see alignment E=3.2e-49

Best Hits

Swiss-Prot: 70% identical to CATF_ACIAD: Beta-ketoadipyl-CoA thiolase (catF) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4000)

MetaCyc: 81% identical to 3-oxoadipyl-CoA thiolase (Cupriavidus necator H16)
3-oxoadipyl-CoA thiolase. [EC: 2.3.1.174]

Predicted SEED Role

"Acetyl-CoA acetyltransferase (EC 2.3.1.9) @ Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)" (EC 2.3.1.-, EC 2.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.174, 2.3.1.9

Use Curated BLAST to search for 2.3.1.- or 2.3.1.174 or 2.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISQ5 at UniProt or InterPro

Protein Sequence (400 amino acids)

>HSERO_RS19990 acetyl-CoA acetyltransferase (Herbaspirillum seropedicae SmR1)
MKDVFICDAIRTPIGRYGGALKDVRADDLGAVPLRALMERNPQVDWKAVDDVIYGCANQA
GEDNRNVARMSLLLAGLPQEVPGSTINRLCGSGMDALGTAARAIKSGETQLMIAGGVESM
TRAPFVMGKADSAFSRQAAIQDTTIGWRFVNALMKQKYGVDAMPETAENVAVDFKVSRAD
QDQFAVRSQAKAAAAQANGTLAQEIVPVVIPQKKGDPITVTQDEHPRATSMEALARLKGV
VKPDGSVTAGNASGVNDGACALLLASAEAVEKYQLKPRARILGMATAGVAPRIMGMGPAP
ASKKVLAQLGMTIDQMDVIELNEAFASQGLAVLRELGVADDDARVNPNGGAIALGHPLGM
SGARLVTTATYQLERTGGRYALCTMCIGVGQGIAMVIERV