Protein Info for HSERO_RS19935 in Herbaspirillum seropedicae SmR1

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF02627: CMD" amino acids 39 to 124 (86 residues), 53.1 bits, see alignment E=8e-18 TIGR02427: 3-oxoadipate enol-lactonase" amino acids 164 to 417 (254 residues), 258.7 bits, see alignment E=2.5e-81 PF12146: Hydrolase_4" amino acids 176 to 402 (227 residues), 77.7 bits, see alignment E=2.6e-25 PF00561: Abhydrolase_1" amino acids 180 to 404 (225 residues), 107.3 bits, see alignment E=3.2e-34 PF12697: Abhydrolase_6" amino acids 181 to 411 (231 residues), 85.2 bits, see alignment E=3.2e-27 PF00975: Thioesterase" amino acids 185 to 264 (80 residues), 31.8 bits, see alignment E=4.9e-11 PF03096: Ndr" amino acids 224 to 337 (114 residues), 31.1 bits, see alignment E=3.2e-11

Best Hits

KEGG orthology group: None (inferred from 61% identity to mpt:Mpe_A3531)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>HSERO_RS19935 hydrolase (Herbaspirillum seropedicae SmR1)
MSYDPLDHDFERGMRNRRSVLGDQWVDRSVANATNFNADFQNLITRFAWNEIWGRPGLDH
KTRRIIVLAITIALGRWEEFELHVRAGLTADPATRLTPDEMKEVMIQAAVYAGVPAGNTA
FTHAQKILREVGEQIGYAVAPQAPAASVHPGVGREGRTASSPALHYTVREPRNGKAPRHT
VVLSHALGTDLMMWDGLANQLAADCRVIAYDHRGHGSSEKADGLYSMADLADDAARLLRE
LDSGPVVWVGLSMGGMVGQELALRHPGLVRALVLANTTSAYPDAAREAWQQRIATVRAEG
IEVIADAVMGRYFHEGFRSAQAATVARYRQRLVTTDAVGYVGCCHAVGTVDTAARLGSIR
VPTLVIAGELDQGTPVAMAQALVDGISGARLAVIAGASHVSAVEQPALFAELVCGFIDGI