Protein Info for HSERO_RS19670 in Herbaspirillum seropedicae SmR1

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 789 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details amino acids 39 to 40 (2 residues), see Phobius details transmembrane" amino acids 37 to 38 (2 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 360 to 385 (26 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details amino acids 620 to 638 (19 residues), see Phobius details amino acids 643 to 661 (19 residues), see Phobius details amino acids 667 to 692 (26 residues), see Phobius details amino acids 716 to 736 (21 residues), see Phobius details amino acids 748 to 771 (24 residues), see Phobius details PF03176: MMPL" amino acids 205 to 408 (204 residues), 25.1 bits, see alignment E=8.5e-10 amino acids 551 to 774 (224 residues), 67.6 bits, see alignment E=9.8e-23 PF00873: ACR_tran" amino acids 222 to 434 (213 residues), 29.2 bits, see alignment E=2.2e-11

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 100% identity to hse:Hsero_3939)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISJ4 at UniProt or InterPro

Protein Sequence (789 amino acids)

>HSERO_RS19670 RND transporter (Herbaspirillum seropedicae SmR1)
MRFLNGFLSLARLEALAFRARVAILLALLAFTALMAVFSLQLRMDAGFEKQIPSDHEYVA
TQHQYRDELFGANRLNIVLRARHGSIWTKEGLTRLNAMTQAVMFLPNVNRLGVQSLWTPN
TFVNEITEEGFRADPVIAGTVTPESLTPEVIASIRDSANNGGFVGTLVSRKQDSAMIIAE
INEFDANGKKVDYLAYNKLLNDLRAKYENADFEVQIIGFAKQIGDVADGAQGVLKFCIMA
LLLTALAVYWYCRSLPFTLLPIVCSLVSLVWQFGTLHLLGYGLDPLAVLVPFLVFAIGVS
HGVQQINYIVRGIAAGMGCEEAARASFRGLLVPGVLALVTAFVSFITLTLIPIPMVKELA
ITASIGVGYKIITNLVMLPLAASLLKVNKAYADAAMRAQQKRARWLQVFARAAHPRNARV
IVVVTLALFAASVWYSSDRLVGTLQAGAPELRADSRYNLDAKSISDNYDTGLDWLSVILA
TPENSCDKVAFGRYQEQFDAAMRHVPGVMSVSSFAEQMKIYNEGYNEGNPSMYSVPLDPA
NYAALAVEIGRVRGFLSKDCSMLATHLYLTDHKASTINGIIAAVKQYRAAHPLPGLTIRL
AAGNAGVIAAVNEEVEKSELPMMLYVYAAIIVLVFAVYRDLRAVVACCLPLTVATFIGYA
FMKQLQIGLTVATLPVMVLAVGIGVDYAFYIYSRLQMHLAAGEAIAVALEKSIQEIGVAT
IFTAITLAIGVATWSFSQLKFQADMGKLLAFMFIVNLIMAMTALPAFAVVLERMFPRKGK
IKVNSMMNH