Protein Info for HSERO_RS19065 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF10518: TAT_signal" amino acids 7 to 27 (21 residues), 25 bits, see alignment (E = 1.3e-09) TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 8 to 35 (28 residues), 25.7 bits, see alignment (E = 1e-09) TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 43 to 298 (256 residues), 242.5 bits, see alignment E=5.1e-76 PF03480: DctP" amino acids 44 to 316 (273 residues), 253.5 bits, see alignment E=2.6e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3818)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRV3 at UniProt or InterPro

Protein Sequence (344 amino acids)

>HSERO_RS19065 ABC transporter substrate-binding protein (Herbaspirillum seropedicae SmR1)
MAQSTGKITRRNFLKTASVASAAAATGLVSTSAHAAEFTFKYANNLPVTHPMNARAKEMA
AAIAEQSKGRIELQLYPNNQLGTDTDMLSQVRAGAIDFFTLSPLILGTLVPAAQISGIGF
AFKDYSQVWPAMDGELGAHVRKQIEARSTLFAFEKIWDNGYRQITNSTKPIKVAEDLKGM
KLRVPPSPLWTSMFKAFDAAPTSINFAEVYSALQTKIVEGQENPMAIISTAKLYEVQKYC
SITNHMWDGFWFLGNKKSFERLPKDLQELMTRIINEAGVNQRADVRKLNDSLVDEMKGKG
LAFNNADADSFRAKLRAAGFYAEWKKKFGDEPWALLEKYTGKLA