Protein Info for HSERO_RS18945 in Herbaspirillum seropedicae SmR1
Annotation: glycerol-3-phosphate transporter membrane protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to UGPE_BRUME: sn-glycerol-3-phosphate transport system permease protein UgpE (ugpE) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to hse:Hsero_3793)Predicted SEED Role
"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See D8IRS8 at UniProt or InterPro
Protein Sequence (283 amino acids)
>HSERO_RS18945 glycerol-3-phosphate transporter membrane protein (Herbaspirillum seropedicae SmR1) MIERRPILDFLSHVVLVLGVLIVFFPLYVAFVASTQSAEQSALSPLSLAPGGEFMNNYST VLFKGAAGQVTAPPVLHMLWVSLATALIIAIGKISISMLSAFAIVYFRFPGRGLFFWMIF VTLMLPVEVRITPTYQVVSDLGMLNSYAGLSVPLIASATATFLFRQFFLTVPDELAEAAR IDGAGPLRFLKDVLWPLSRTNVIALFVIMFIYGWNQYLWPLIIATDTSMYPIGIGIKTLI SGGDSAVEWNLVMATMILAMLPPGLVVVVMQKWFVKGLVDSEK