Protein Info for HSERO_RS18690 in Herbaspirillum seropedicae SmR1

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 43 to 231 (189 residues), 165.4 bits, E=1.7e-52
• PF08659: KR
  • amino acids 45 to 211 (167 residues), 34.9 bits, E=2.2e-12
• PF13561: adh_short_C2
  • amino acids 51 to 281 (231 residues), 203.5 bits, E=5.8e-64

Best Hits

Swiss-Prot: 56% identical to YHXC_BACSU: Uncharacterized oxidoreductase YhxC (yhxC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 64% identity to azo:azo1732)

MetaCyc: 56% identical to aldehyde reductase (chloroplastic) (Arabidopsis thaliana col)
Aldehyde reductase. [EC: 1.1.1.21]; Alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.21, 1.1.1.2]; 1.1.1.2 [EC: 1.1.1.21, 1.1.1.2]; 1.1.1.- [EC: 1.1.1.21, 1.1.1.2]; 1.1.1.- [EC: 1.1.1.21, 1.1.1.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• methylglyoxal degradation III (1/2 steps found)
• D-arabinose degradation V (1/3 steps found)
• L-arabinose degradation II (1/3 steps found)
• glycerol degradation to butanol (10/16 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• superpathway of methylglyoxal degradation (4/8 steps found)
• D-xylose degradation to ethylene glycol (engineered) (1/4 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (1/4 steps found)
• detoxification of reactive carbonyls in chloroplasts (4/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• traumatin and (Z)-3-hexen-1-yl acetate biosynthesis (3/12 steps found)
• superpathway of pentose and pentitol degradation (19/42 steps found)
• superpathway of lipoxygenase (4/22 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Caprolactam degradation
• Carotenoid biosynthesis - General
• Fructose and mannose metabolism
• Galactose metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Pyruvate metabolism
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.2 or 1.1.1.21

Protein Sequence (286 amino acids)

>HSERO_RS18690 short-chain dehydrogenase (Herbaspirillum seropedicae SmR1)
MSKTEIDALPAQHQSHQPGSEQQMEPRPHSAPAGEPGRRLAGKVALITGGDSGIGRAVAL
AYAREGARLAIVYLDEEEDARQTQKDVQALDAPCLLLPGDVGSPEFCRSAVRAVMDAYGR
LDVLVNNAAQQYPAQSIEEISQAQLEHTFRTNIFSMFYMVKEAMPFLTRGARIINTTSVT
AYRGSKHLVDYAATKGAIVAFTRSLSQQLASAGIHVNAVAPGPIWTPLIPASFSAEEVAS
FGKNVPLGRPGQPDEVAPAYVFLATEGASYMTGQVLHPNGGEIVNT