Protein Info for HSERO_RS18570 in Herbaspirillum seropedicae SmR1

Annotation: maleylacetate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00465: Fe-ADH
  • amino acids 11 to 337 (327 residues), 271.6 bits, E=9.5e-85
• PF13685: Fe-ADH_2
  • amino acids 43 to 250 (208 residues), 38 bits, E=1.6e-13

Best Hits

Swiss-Prot: 64% identical to TFTE_BURCE: Maleylacetate reductase (tftE) from Burkholderia cepacia

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3721)

MetaCyc: 64% identical to maleylacetate reductase (Paraburkholderia phenoliruptrix)
Maleylacetate reductase. [EC: 1.3.1.32]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (15/19 steps found)
• heterolactic fermentation (14/18 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• mixed acid fermentation (12/16 steps found)
• ethanolamine utilization (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• resorcinol degradation (2/3 steps found)
• ethanol degradation I (1/2 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• 3-chlorocatechol degradation II (ortho) (3/5 steps found)
• 4-chlorocatechol degradation (3/5 steps found)
• acetylene degradation (anaerobic) (3/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• γ-resorcylate degradation I (2/4 steps found)
• γ-resorcylate degradation II (2/4 steps found)
• 4-aminophenol degradation (2/4 steps found)
• 4-sulfocatechol degradation (2/4 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• 2,4,6-trichlorophenol degradation (4/7 steps found)
• 4,5-dichlorocatechol degradation (4/7 steps found)
• L-methionine degradation III (1/3 steps found)
• pyruvate fermentation to ethanol I (1/3 steps found)
• pyruvate fermentation to ethanol III (1/3 steps found)
• 3,4,6-trichlorocatechol degradation (5/9 steps found)
• 3-chlorocatechol degradation I (ortho) (2/5 steps found)
• 4-nitrophenol degradation II (2/5 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• 3,5-dichlorocatechol degradation (4/8 steps found)
• cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
• γ-hexachlorocyclohexane degradation (6/11 steps found)
• chlorosalicylate degradation (3/7 steps found)
• serotonin degradation (3/7 steps found)
• 1,4-dichlorobenzene degradation (4/9 steps found)
• 2,4,5-trichlorophenoxyacetate degradation (4/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• 4-hydroxyacetophenone degradation (1/5 steps found)
• 4-nitrophenol degradation I (1/5 steps found)
• pentachlorophenol degradation (4/10 steps found)
• butanol and isobutanol biosynthesis (engineered) (2/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• pinoresinol degradation (2/10 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Benzoate degradation via hydroxylation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Retinol metabolism
• Tyrosine metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.3.1.32

Sequence Analysis Tools

See D8IR73 at UniProt or InterPro

Protein Sequence (356 amino acids)

>HSERO_RS18570 maleylacetate reductase (Herbaspirillum seropedicae SmR1)
MQAFTYTSAAARVIFGHGSLQHLVRETELLGAQRALVLCTPGQRAEAERVAALIGARCAG
IFDQAVMHVPIETARHAREVARALGADCAIAIGGGSTMGLGKAIALESELPILAIPTTYA
GSEMTPIYGLTEAGRKKTGRDARVLPRTVIYDPALSLGLPLDLSVTSGINAMAHAAEGLY
APDANPIMSLLAEEGLRALAEGLPQLAARADDIDARSRCLYGAWLCGTVLGNVGMSLHHK
LCHTLGGSYNLPHAQTHTVILPHALAYNAAAAPQAMQRIARALGVEDAAQGVYALARALH
APLSLKELGMPYEALAQCTEIALQNAYANPRPLQREALHALLEDAWHGRPPAGGRD