Protein Info for HSERO_RS18520 in Herbaspirillum seropedicae SmR1

Annotation: exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 810 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 262 to 280 (19 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 432 to 454 (23 residues), see Phobius details amino acids 660 to 679 (20 residues), see Phobius details amino acids 688 to 706 (19 residues), see Phobius details amino acids 712 to 732 (21 residues), see Phobius details amino acids 743 to 763 (21 residues), see Phobius details amino acids 769 to 790 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3712)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IR64 at UniProt or InterPro

Protein Sequence (810 amino acids)

>HSERO_RS18520 exporter (Herbaspirillum seropedicae SmR1)
LTKPARHLQRLPRLLALAWLLAVLLVAGHNAWLWLGQRASPDTDILALLPGASSKDAVRQ
QAFSHMVDSAQQKLVVLVGDRDWKRAQAGAQAYLTVLHAHADLVAPINDDSAQWQSQWLG
SLDRSRSLLLGDAQRAQLATTTAQQWNQRALGGLYGAFGGPRLGAWQDDPFGLFGDWVQE
RARETPVRPRDGMLFVERDGVSYALLLLELKAPAFSMQAQEQVVPLLAQARRAARTQAGE
VVSGGVVLHAAAASAQASSESATIGAGSLLGILLLMWLTFRSLKPILYIALSIAVGCLGA
LSVSMLVFGKIHLLTLVFGASLIGIAQDYGIYFLCARLAAPATQDSATLLRRLLPGLALM
LLAALIGYLGMALTPFPGLQQMAVFSALGLVFAWLTVACWFPQLIGPQTLCATPRAQGFG
QSIARWPDLLGGFAWHLVLPAAVALIGLAIAGVARLHSSDDIRALQKSPPELLQDQMRIS
QLLELAAPVQFYLVRGASAEAVLQQEEALREKLQALVQRKLITGVQAVSNWAPSQQRQQD
NLALLRRALLEPQGESPDAVTLTAQAIGESPQWAQALRQRMLDKTQPITPEEFLATPAGA
ASRHLWLGQVDGQFASIVALRGLTDYRQLGQLAAVAEGMPGVQWVDKVGEISSVLRQYRI
YMGWALLCAYAAIFALLALRYRRRAWRALAPPLLASLLTLGLFGWLGQPLQLFHVLAGLL
VLGLGVDYGIFLLESSRDQRPHAWLTVALSAASALLSFGLLALSHSPPLHAFGLTMLCGM
LLVWLLAPLFTHPGPAAHATPDAQPDKESA