Protein Info for HSERO_RS18085 in Herbaspirillum seropedicae SmR1

Annotation: pyrimidine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 62 to 78 (17 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 288 to 301 (14 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 345 to 374 (30 residues), see Phobius details amino acids 386 to 399 (14 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 28 to 425 (398 residues), 364.2 bits, see alignment E=4.7e-113 PF00860: Xan_ur_permease" amino acids 33 to 403 (371 residues), 321.7 bits, see alignment E=2.9e-100

Best Hits

Swiss-Prot: 73% identical to RUTG_ECOLI: Putative pyrimidine permease RutG (rutG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3624)

MetaCyc: 73% identical to pyrimidine:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN-132; TRANS-RXN-362

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQJ0 at UniProt or InterPro

Protein Sequence (431 amino acids)

>HSERO_RS18085 pyrimidine permease (Herbaspirillum seropedicae SmR1)
MSGSYFPQWRLRQSTNDGQGAVIAADERLPAPQTLAMGVQHVVAMFGSTVLAPLLMGFDP
NLAILMSGVGTLLFFLLVGGRVPSYLGSSFSFIGLVIAVTGYAGSGPNTNLGVALGGIIA
CGAVYAVIGLIVAGVGTRWIESLMPPVVTGAVVAVIGLNLAPIAVKGVSGSSFDSWMALA
TILCVGGVAVFTRGMLQRLLILVGLLLAYVLYAVLTNGLGLGKPIDFSTVANAAWFGVPH
FAAPVFHAGAMALLAPVAIILVAENLGHIKAVSAMTGQNLDRYIGRAFVGDGLATMLSGS
VGGTGVTTYAENIGVMAVTKIYSTLVFVVAAVIAILLGFSPKFGAVILTIPGAVLGGVSI
VVFGLITISGARIWVENKVDFSNNTNLIVAAVTLVLGAGDFTLKLGGFALGGIGTATFGA
IILHALLKRRA