Protein Info for HSERO_RS18020 in Herbaspirillum seropedicae SmR1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 721 PF08448: PAS_4" amino acids 47 to 149 (103 residues), 27 bits, see alignment E=1.6e-09 amino acids 165 to 276 (112 residues), 25.5 bits, see alignment E=4.6e-09 PF13426: PAS_9" amino acids 51 to 146 (96 residues), 28.8 bits, see alignment E=4.2e-10 amino acids 170 to 261 (92 residues), 38.8 bits, see alignment E=3.3e-13 TIGR00229: PAS domain S-box protein" amino acids 52 to 154 (103 residues), 46 bits, see alignment E=5.3e-16 amino acids 155 to 281 (127 residues), 63.9 bits, see alignment E=1.6e-21 PF08447: PAS_3" amino acids 54 to 140 (87 residues), 73.8 bits, see alignment E=3.9e-24 amino acids 182 to 269 (88 residues), 41.6 bits, see alignment E=4.3e-14 PF00989: PAS" amino acids 160 to 265 (106 residues), 35 bits, see alignment E=4.6e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 283 to 446 (164 residues), 167.3 bits, see alignment E=2.5e-53 PF00990: GGDEF" amino acids 286 to 444 (159 residues), 185.9 bits, see alignment E=1.6e-58 PF00563: EAL" amino acids 466 to 698 (233 residues), 263.2 bits, see alignment E=7.2e-82

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3610)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQH6 at UniProt or InterPro

Protein Sequence (721 amino acids)

>HSERO_RS18020 diguanylate cyclase (Herbaspirillum seropedicae SmR1)
MKTAASPASCRPDPDQNRAVVAIPRSPRLLETLLVNLDGVVYRCRDDAQWTMEFVSEGCL
ALTGYLPEDLLLNQRLSFLELTHPEDRTLVRNHVDACMRERRRIDIEYRIVRADGAVRWV
WERGVGIYNANGQVEAIEGFLQDVTERKEAAQALQEAERRYRSIFENAIEGVFQTTPDGT
YIAVNPALARIYGYHSPEDLIVGLRDISHQLYVEPERRQEFMRLMEEQGSVSNFESRVYR
RDGEIIWISENARAVYDEAGKLSCYEGTVEAITERKAHEAEMRHQATHDALTGLPNRNML
HEHLQRALRVARQKGALTAVAFVDLDQFKFINDSLGHQVGDELLKTVAQRLQACLREADM
VARQGGDEFVLVLQNQTEGEAGIAEVMQRILAAVARPWQAGDREFQVTASIGVSRYPADG
KDVESLLKHADSAMYRAKEQGRNNFQFFAPWMDSQVSNRLEMLINLRRALDQDEFKLYYQ
PKLSLQDGRLIGAEALIRWESPQQGMVPPDRFIPFAEEAGLIVPIGEWVLRTACRQNQAW
QQAGLPPIPVAVNLSPRQLNQSLPDFVAGVLAQSGLAASWLELEITENVVMKDAEKSVAT
LHALKRLGLQISVDDFGTGYSSLSYLRRFPVDALKIDKSFVRDIVRDADSAAIVKAIISL
AHILNLRVIAEGVEDEEQHAFLKENACDEVQGYYFGKPMEVAVFTAWMSEQAQAGQVLSC
K