Protein Info for HSERO_RS17985 in Herbaspirillum seropedicae SmR1

Annotation: tRNA pseudouridine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 38 to 243 (206 residues), 265.8 bits, see alignment E=1.4e-83 PF01509: TruB_N" amino acids 59 to 206 (148 residues), 196.7 bits, see alignment E=4.2e-62 PF16198: TruB_C_2" amino acids 207 to 265 (59 residues), 50 bits, see alignment E=3.8e-17 PF09157: TruB-C_2" amino acids 269 to 331 (63 residues), 47.7 bits, see alignment E=1.7e-16

Best Hits

Swiss-Prot: 66% identical to TRUB_BURPS: tRNA pseudouridine synthase B (truB) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 100% identity to hse:Hsero_3602)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQG8 at UniProt or InterPro

Protein Sequence (334 amino acids)

>HSERO_RS17985 tRNA pseudouridine synthase B (Herbaspirillum seropedicae SmR1)
MADDTTADTMSAPPDTAQPRAKRGQPVRTPRLPRVPVHGVLLLDKPVGLSSNDALIRAKR
MLNAPKAGHTGTLDPFATGLLPLCFGEATKFSQDLLEADKTYEAVVHLGVRTDTGDTEGQ
VLSERPVEVSVEQIEAAMAQFRGPISQVPPMHSALKRDGKPLYEYARAGITLEREARNVT
IHALELLNYQAPMLRIRVTCSKGTYIRVLGEDIGEVLGCGAHLNALRRIGVGPLTLEGAV
TLESVDAAGELEARKALLLPVDGLLRSFPAVQLSDELARRFLHGQRLPLGKEGVAVPQQT
GRVRVYRSSDAALLGTGLLQEYAILAPERLVSTA