Protein Info for HSERO_RS17930 in Herbaspirillum seropedicae SmR1

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 350 (343 residues), 100.4 bits, see alignment E=5.5e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3592)

Predicted SEED Role

"Acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQF8 at UniProt or InterPro

Protein Sequence (359 amino acids)

>HSERO_RS17930 acyltransferase (Herbaspirillum seropedicae SmR1)
MSIAQRNARIDVLRGVSILLVLFHHFNIAYPLKDTVPATIFATPVVQAIARNGNYGVTIF
FVISGYLMTANTLRRWGRLDAIDARRFYALRAWRILPCMFLLLAMVSLLAALGGTLFQNR
GFGEPPLPMWMTALASLTFWMNVLIAQHGWVNYPLGVLWSLSVEGVFYLAFPVVCLTLRR
PLFIGAFCLLFIVAGPLYRLAHQGDEGGFLYAYLACFDGIAIGCCTAILVARGTHPWIST
RWLQCMTILAMALLYLCWPISRSNVLGVTAMALGTALLLAGASGKTVAARSAGYSFLAFC
GGLSYEIYLFHLIVLGLMRTAIPPITASSEVKLGLLAGYLICSLGVACAVARFFSRPFN