Protein Info for HSERO_RS17545 in Herbaspirillum seropedicae SmR1

Annotation: glutamine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 110 (99 residues), 103.8 bits, see alignment E=2.8e-34 PF00528: BPD_transp_1" amino acids 33 to 216 (184 residues), 78.7 bits, see alignment E=2.5e-26

Best Hits

Swiss-Prot: 58% identical to GLNP_SHIFL: Glutamine transport system permease protein GlnP (glnP) from Shigella flexneri

KEGG orthology group: K10037, glutamine transport system permease protein (inferred from 100% identity to hse:Hsero_3514)

MetaCyc: 58% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPU6 at UniProt or InterPro

Protein Sequence (218 amino acids)

>HSERO_RS17545 glutamine ABC transporter permease (Herbaspirillum seropedicae SmR1)
VDFDFSVITDSLPALLEGAKVTVLITAAGLVGGTLVGLLAGLMRAYGNTLLKGIGFGYVE
FVRGTPIVVQVMFIYFALPVLLGIRVDPMTAAVTSIVVNSGAYIAEIVRGAFLSVPRGLR
EAGLALGLPVWRVLAFVIGPVAIRRMVPAMGNQFIVSLKDTSLFIVIGVGELTRQGQEIM
AANFRAVEIWIAVAAIYLCMIGVMTYALRTFEKRMRIL