Protein Info for HSERO_RS17540 in Herbaspirillum seropedicae SmR1

Annotation: glutamine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00005: ABC_tran" amino acids 17 to 165 (149 residues), 131.7 bits, see alignment E=4.4e-42 PF13304: AAA_21" amino acids 135 to 195 (61 residues), 30.4 bits, see alignment E=6.7e-11

Best Hits

Swiss-Prot: 73% identical to GLNQ_ECOLI: Glutamine transport ATP-binding protein GlnQ (glnQ) from Escherichia coli (strain K12)

KEGG orthology group: K10038, glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to hse:Hsero_3513)

MetaCyc: 73% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPU5 at UniProt or InterPro

Protein Sequence (240 amino acids)

>HSERO_RS17540 glutamine ABC transporter ATP-binding protein (Herbaspirillum seropedicae SmR1)
MVEFKSVSKRFGSNVVLDGINLTIRKGEVVVLIGPSGSGKSTLLRCINALEEIDGGDLLV
DGISVLSGSSSVRAIRQEAGMVFQQFNLFPQLTALENVAFGPRHVRGASSEEANALASEL
LAKVGLAERKHHYPNELSGGQQQRVAIARALAVRPKLMLFDEPTSALDPELRQEVLRVMQ
SLAEEGMTMIVVTHEISFARRVGTRLIFMENGHIAIDGNPGELIENSCNPRLREFLKHVE