Protein Info for HSERO_RS17345 in Herbaspirillum seropedicae SmR1

Annotation: AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 54 to 71 (18 residues), see Phobius details PF13412: HTH_24" amino acids 8 to 54 (47 residues), 57.9 bits, see alignment E=1.5e-19 PF13404: HTH_AsnC-type" amino acids 8 to 49 (42 residues), 51 bits, see alignment E=2.5e-17 PF08279: HTH_11" amino acids 13 to 54 (42 residues), 26 bits, see alignment E=1.7e-09 PF01037: AsnC_trans_reg" amino acids 75 to 147 (73 residues), 62.4 bits, see alignment E=7.4e-21

Best Hits

Swiss-Prot: 42% identical to Y224_HAEIN: Uncharacterized HTH-type transcriptional regulator HI_0224 (HI_0224) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to hse:Hsero_3464)

Predicted SEED Role

"Putative HTH-type transcriptional regulator ybaO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPP7 at UniProt or InterPro

Protein Sequence (170 amino acids)

>HSERO_RS17345 AsnC family transcriptional regulator (Herbaspirillum seropedicae SmR1)
MAAKHHTLDKVDRKLLNMLQKDNQISTRVLAEKLHISQPTCLRRIRDLREAGIISAEVAM
VDPFALGYGMLAFLEISLNNQSDQHMQDFEQRMAKEAEVMQCYFVSGEYDYFLAVHVIDM
DAYYQFVRRVISGSGNVRHFQSRFPMKRAKFTTRIAFDEKAAEVLVRVPG