Protein Info for HSERO_RS17050 in Herbaspirillum seropedicae SmR1

Annotation: type IV secretion protein Rhs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 824 TIGR03361: type VI secretion system Vgr family protein" amino acids 29 to 503 (475 residues), 418.1 bits, see alignment E=5e-129 TIGR01646: Rhs element Vgr protein" amino acids 37 to 531 (495 residues), 385.5 bits, see alignment E=4.3e-119 PF05954: Phage_GPD" amino acids 44 to 353 (310 residues), 253.4 bits, see alignment E=6e-79 PF04717: Phage_base_V" amino acids 407 to 474 (68 residues), 42.1 bits, see alignment E=1.8e-14 PF13296: T6SS_Vgr" amino acids 509 to 613 (105 residues), 113.2 bits, see alignment E=1.4e-36 PF10106: DUF2345" amino acids 647 to 794 (148 residues), 167.2 bits, see alignment E=4.6e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3405)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPI9 at UniProt or InterPro

Protein Sequence (824 amino acids)

>HSERO_RS17050 type IV secretion protein Rhs (Herbaspirillum seropedicae SmR1)
MHSHTTRWDKLTRQRQHNRILQLFFINDDAPDAELLINRLEASEALSRDYVYTLELLSDD
AHIPLDAMMGKLLRVALTRADGTQRHFTGYVERFAFLRSDGGIAFYEARLVPWLAFLASR
HNNRIFHHLSLEGLSAAIFRAYPMHARWDCQLRHGDPVRTEMFQFDESDSNLLHRRWEDA
GWHYHYEHQADGHQLRLSDDSTYAKPIDGTGQVPFQRHGGAIEEDGMAQWSAVRQFQPSS
TRLSSYDFKAARPQEVEVPTLNKQGAVLQVEHYEYAGAYGFANRDDGDRQSRLRMEEFEA
AAQVFEGTGNCRFLQPGRTFRLTGHFSGSAASHDHDRDPELLIISVEHSATNNYLQDSET
PPFYANRVRCVRKRIPWRPGRSYYSQPTALLGIQTATVVGPAGENLHVDEYGRVKVQFHW
DQIGRNDERSSAWLRVASSWSGGEQGLVSVPRIGQLVIVQWLGGHPDRPIITGSVVNQLN
MPPWTLPSQSALSGMRSRELAPRTGNAPGGRSGHVLFDDTHEAIQTQVRSDAFDSQLALG
HITRIERHAGRQDARGEGFELRTDAHGVVRAAQGLLLTSEPRPKAHRHTTDIGETVARLT
QARGTVESLSKLAQEHEAQDKNADQYDAAQAIKAQNDAIKGDGAAKGGRFPELTEPHLVL
SSPSGIEASSGASTHLASAEHAALTAGSHISLAAGKSFFASAAEKLSLLAYRLGAKLIAA
SGRVEIQAQNDGMELLAQKVVDIISTRDWINLKAKKGIRLNGGGSELVIAEGITGFTQGA
HHVHAADHQTLGPQGRPAEFPGSRLCPARASGAAQSGSASVVLS