Protein Info for HSERO_RS16970 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 195 to 225 (31 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 277 (173 residues), 97.3 bits, see alignment E=4.7e-32

Best Hits

Swiss-Prot: 30% identical to YTLD_BACSU: Uncharacterized ABC transporter permease protein YtlD (ytlD) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to hse:Hsero_3387)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J285 at UniProt or InterPro

Protein Sequence (284 amino acids)

>HSERO_RS16970 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MTQAQASQSAATMDIAAVEAEAQRKIRARKQLVIGLRIAILVIVLGGWEVCARIGWIDPF
FFSQPSLIVAQIYDWMVEGTSQGPLWTQVLVTLEETVLGFLIGSVAGVIAGIVLGRNKLL
SDVFSLYIQIANSIPRVVLGSIFVIAFGLGMASKVALAVVMVFFVVFANAFQGVREADRY
MIANAQILGASRRQVTMAVVIPSALSWILASLHVSFGFALVGAVVGEFLGSKQGIGLLIS
TAQGAFNASGVFAAMIVLAVVALAADWLLHALERRLLKWRPQAF