Protein Info for HSERO_RS16955 in Herbaspirillum seropedicae SmR1

Annotation: TonB-denpendent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 738 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07715: Plug" amino acids 67 to 166 (100 residues), 81.9 bits, see alignment E=4.6e-27 TIGR01783: TonB-dependent siderophore receptor" amino acids 70 to 736 (667 residues), 275.5 bits, see alignment E=5.5e-86 PF00593: TonB_dep_Rec" amino acids 246 to 705 (460 residues), 178.9 bits, see alignment E=3.4e-56

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to hse:Hsero_3384)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J282 at UniProt or InterPro

Protein Sequence (738 amino acids)

>HSERO_RS16955 TonB-denpendent receptor (Herbaspirillum seropedicae SmR1)
MNRLTPIAAALVATFAAPLSLHAQQVSPTTTSAGKPAADGQLAPVTVQGQRDDFASTGTA
LTKLPADLRDVPQSVTVVNKAQMQSQGASSLSDALRNVSGITLGGAEGGQIGNNINLNGF
SARTDIYLDGFRDRGQYYRDTFAIDEVEVLMGPSSMLFGRGSTGGIINQVSKKANLKAAT
EISGSITTNGLVRSTVDVNRPLSDTSALRIEAMAQNGAASTRKQTDVQDFGLAGSYVWGI
GTPTEITLSALLQHNQDQPDYGLPPLNGHPANVGRDTAYGLNSDRTIQDVASFNVGVKHK
IAPDVTLRNQTQFNYVHTDAVETAPNTIGTVSGAGFTQLVNASSNLPLSSLFVRGQSHDR
VITDYSIFNQTELTAKFATGSIKHDAVVGVEVGHDGYDNQNYYRNGSCNGTALNANGATT
GYVDCVPLLNPSYSAAGSSVSSSTGNRAGGSANTVAAYVGDTVELVPQFKLVGGLRYDRY
IASITNSIASARTPAAASQTINFLSLRSGAIWQPTSAQAYYVSYGTSFNPSLEQLTGTQG
QQNLDPEKNRSYELGGKWDLADGLALTAAAFQITKDNARSQVATGVYALAGKVRVNGARA
GATGHITREWQVAANYTYLGAKVLEGAAGDNSVGKVPVNTPKHTLTTWTTYDLAPHWQIG
GGASYMSQRYADAPNTVQVGGYTRYDAMLAYTTKAYDIRLNLYNLSNKMYYDALIQSDGG
RSVPGSGRTALLSLTYRM