Protein Info for HSERO_RS16845 in Herbaspirillum seropedicae SmR1

Annotation: orotidine 5'-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 80% identical to PYRF_HERAR: Orotidine 5'-phosphate decarboxylase (pyrF) from Herminiimonas arsenicoxydans

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 100% identity to hse:Hsero_3365)

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
UMP biosynthesis I (6/6 steps found)
UMP biosynthesis II (6/6 steps found)
UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J263 at UniProt or InterPro

Protein Sequence (272 amino acids)

>HSERO_RS16845 orotidine 5'-phosphate decarboxylase (Herbaspirillum seropedicae SmR1)
VTFIEKLNAAWTSRNSLLCVGLDPDLKKFPAELQGKPDAIFEFCRAIIDATAEAACAFKP
QIAYFAALGAEEQLERICAYLRSNYPDIPLVLDAKRGDIGATAEQYAREAFERYDADVVT
VSPYMGWDSVSPYLEWKDRGVIVLCRTSNAGGSDLQFLEVDGKPLYQHVARLVAEKWNTN
GQCGLVVGATFPQELAQVRAIIGDMPLLVPGVGAQGGDVQATVTAGKTAAGTGMMINSSR
AILYATPQAGEDFAAAARRVAIETRDAINRFR