Protein Info for HSERO_RS16755 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details PF05987: DUF898" amino acids 28 to 356 (329 residues), 411.3 bits, see alignment E=1.6e-127

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3345)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J243 at UniProt or InterPro

Protein Sequence (363 amino acids)

>HSERO_RS16755 membrane protein (Herbaspirillum seropedicae SmR1)
MNEPSDLPSQATPPFSTVLNTAAPVKPEAFSFSGRGGEYFRIWIVNLLLSIVTLGIYSAW
AKVRRLRYFYDNTSVAGGSFDYHGNPIAILKGRIIAVVLLAVYNFAGAASPLLGLAAALL
LVLAGPWLLWRSLQFKLYNTSYRGIRFGFRGSLGGAARNFLMWPMLASISLGLLAPLAYQ
RFKRYQHSEARFGATHFSFHGSVGAFYKTFLIGLGLWLGGIIVIFVGFGGITLIQMVHAG
TTAVFSLMLMVLALYAWTFLALPLWMTLLQNLVWNNTRLGEHRFQSDMRWGRTAFIVFTN
VLGVVFTLGLYTPFAQIRMMRYRIESLTLLPASSLDDFVASSEAHGSATGEGLGDLLDFD
LSM