Protein Info for HSERO_RS16730 in Herbaspirillum seropedicae SmR1

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 86 to 111 (26 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 107 to 287 (181 residues), 64.7 bits, see alignment E=4.8e-22

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to hse:Hsero_3340)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J238 at UniProt or InterPro

Protein Sequence (293 amino acids)

>HSERO_RS16730 sugar ABC transporter permease (Herbaspirillum seropedicae SmR1)
MAKKKDDQQETQGMDFLQSTPRKWVTIYIPLLIFLFVLLFPFYWMVITAFKPDNELLSQS
GNPFWVIAPTLAHFKKLLFDTQYPAWLLNTVIVSVVSTFASLAASVFAAYAIERLRFQGS
KQVGLGIFLAYLIPPSILFIPLAAIVFKLGLFDTRWALILTYPTFLIPFCTWLLMGYFRS
IPYELEECALIDGATRWEILVKIILPLAVPGLISAGIFAFTLSWNEFIYALTFISSSEVK
TVPVGIVTELVEGDVYHWGALMAGALLGSLPVAVVYSFFVEYYVSGMTGAVKE