Protein Info for HSERO_RS16655 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 22 to 157 (136 residues), 101.7 bits, E=5.4e-33

Best Hits

Swiss-Prot: 46% identical to Y4187_BRUSU: Putative ATP-binding protein BRA1187/BS1330_II1178 (BRA1187) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to hse:Hsero_3324)

MetaCyc: 42% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"ABC transporter ATP-binding protein with unknown substrate"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

See D8J222 at UniProt or InterPro

Protein Sequence (257 amino acids)

>HSERO_RS16655 ABC transporter ATP-binding protein (Herbaspirillum seropedicae SmR1)
MKLSFNNVAKHFGDLHVIEEFTREIASGELVALVGPSGCGKSTLLHMAAGLEKPSSGSVA
GDGQTIRGPHPERTLMFQENALYPWLTLQQNVALALEFQSVDKKKAAEQARVWLENVKLK
GFEHYYPHQVSGGMRQRAALARAFISQPKALLLDEPFGALDALTRMTLQDALRDLIRQQG
PTVVLVTHDVDEALFLADRIFVFSPRPAKVLKEFNLVHHEKTHDLSEFAAIRRDILCLLG
IHAEQDEFAKNIEGVGV