Protein Info for HSERO_RS16355 in Herbaspirillum seropedicae SmR1

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 30 to 54 (25 residues), see Phobius details amino acids 59 to 60 (2 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 100 to 147 (48 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details amino acids 355 to 372 (18 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details amino acids 493 to 512 (20 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 36 to 510 (475 residues), 452.2 bits, see alignment E=1.2e-139 PF07690: MFS_1" amino acids 38 to 431 (394 residues), 185.6 bits, see alignment E=1.3e-58 PF00083: Sugar_tr" amino acids 41 to 200 (160 residues), 27.1 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 47% identical to EMRB_ECO57: Multidrug export protein EmrB (emrB) from Escherichia coli O157:H7

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 100% identity to hse:Hsero_3269)

MetaCyc: 47% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1W7 at UniProt or InterPro

Protein Sequence (525 amino acids)

>HSERO_RS16355 DSBA oxidoreductase (Herbaspirillum seropedicae SmR1)
MSSTLSADAAGAPAPAPQPAPFEAPLSGGQLVGAGILLAAANFIAVLDTTIANVSVSTIA
GALGASTSQGTYVITSYAVAEAITVPLTGWLANRFGTVRVFILSMVMFGLFSALCGMANS
LGMLIAFRVLQGLAGGPLMPLSQTLLLRIFPKEKAPAAVGLWAMTTLVAPIAGPILGGVL
CDQYSWPYIFWINVPVALICGYIGWRMLKRYETKMSKLPIDRVGLVLMVVWVAALQLMLD
EGKEKDWFASTEIVLLAVTAVVFFIAFLIWELTERNPIVDLRVFRHRGFTASVTTICLAF
GAFFGSVVLTPLWLQGYMGYTATWSGCISALTGILAVMTAPMVAKMSTTIDARKLVCIGV
TWLGFITFLRAFNTTDMSFFQIGWPLFLQGIGLPLFFVPLTGLALSSVNEEETASAAGLM
SFCRTMAGAIATSIVNTSWENDATYFHAELSGLVDRGGDAIHTMMASGMSAEQATASLAQ
TVQNQAVMLSTNHIFMMAAVSFSLAALAVWLAPKPTRVADTSAAH