Protein Info for HSERO_RS16350 in Herbaspirillum seropedicae SmR1

Annotation: hemolysin D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 61 to 389 (329 residues), 39.8 bits, see alignment E=7e-14 PF13533: Biotin_lipoyl_2" amino acids 77 to 123 (47 residues), 40.3 bits, see alignment 4.1e-14 PF16576: HlyD_D23" amino acids 188 to 325 (138 residues), 44.9 bits, see alignment E=1.8e-15 PF13437: HlyD_3" amino acids 260 to 371 (112 residues), 58.6 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to hse:Hsero_3268)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1W6 at UniProt or InterPro

Protein Sequence (414 amino acids)

>HSERO_RS16350 hemolysin D (Herbaspirillum seropedicae SmR1)
LIIMSHSDSQAAHTLAEEAKQRNEAASAAAAAQKRKKLFSIFGGVVAIAAIGYGAYWYLI
GSRYVETDNAYTATEIATVTPAINGIVAAVDVVDTQAVKKGDVLVRIDDADARLAVDQAA
ADLDRTERKVKGFFANDAGLAAQVLAREAEQKRASAQLLSAQADLKRAEIDLQRREALAK
SGSVSGEELSNARTALLTAQANLKAAEAAEVQSRANIKATQGAQKASTVLTANTTVDDNP
EVVLARAKLEQAKLDLERTVLRAPVDGVIARRQVQVGQRVQSGATLLSVVPLQQMHVDAN
FKEGQLTKVRIGQPVTMKADLYGGSVEYHGVVTGLSGGTGSAFAVIPAQNATGNWIKVVQ
RLPVRISLDPKELAQRPLSVGLSMVVEIDTRGQIQAGDAQRKSARNDNAQAAAL