Protein Info for HSERO_RS15680 in Herbaspirillum seropedicae SmR1

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 TIGR01818: nitrogen regulation protein NR(I)" amino acids 4 to 394 (391 residues), 636.2 bits, see alignment E=1.6e-195 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 93.7 bits, see alignment E=2.1e-30 PF00158: Sigma54_activat" amino acids 136 to 302 (167 residues), 240.7 bits, see alignment E=1.7e-75 PF14532: Sigma54_activ_2" amino acids 137 to 307 (171 residues), 91.8 bits, see alignment E=1.2e-29 PF07728: AAA_5" amino acids 160 to 279 (120 residues), 39.7 bits, see alignment E=1.2e-13 PF02954: HTH_8" amino acids 453 to 491 (39 residues), 44.1 bits, see alignment 3.4e-15

Best Hits

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to hse:Hsero_3125)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J140 at UniProt or InterPro

Protein Sequence (500 amino acids)

>HSERO_RS15680 chemotaxis protein CheY (Herbaspirillum seropedicae SmR1)
MKPIWIVDDDESIRWVLEKALARENLATQSFSSARDAIAALQNGTPQVLVSDIRMPGASG
LELLQTVKAKHPGIPVIIITAFSDLDSAVSAFQGGAFEYLAKPFDVDKAVELIRRALDES
LRETDIEQGAAQTPEILGQAPAMQDVFRAIGRLSQSNVTVLITGESGSGKELVARALHKH
SPRASQPFVALNTAAIPKDLLESELFGHERGAFTGAQAMRRGRFEQAEGGTLFLDEIGDM
PLDLQTRLLRVLSDGHFYRVGGHQSLKANVRVIAATHQNLEQRVREGLFREDLYHRLNVI
RLRLPSLRERSEDIPILARYFLAQSARQLGVEAKRLSPQAMQFLSQLEFPGNVRQLENLC
NWITVMAPGQTVEIKDLPQDLVEERVHAPQPAQTVAAPASAAALPTAYTEPAPGVASASA
DGAAGASWITLLETEAAQMLASEQPEVMDILGRQFEAALIKVALKHTHGRKNDAAVRLGI
GRNTITRKIQELGIGGAEDD