Protein Info for HSERO_RS15565 in Herbaspirillum seropedicae SmR1

Annotation: sulfate adenylyltransferase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR02039: sulfate adenylyltransferase, small subunit" amino acids 18 to 311 (294 residues), 416.4 bits, see alignment E=4e-129 PF01507: PAPS_reduct" amino acids 39 to 264 (226 residues), 149.7 bits, see alignment E=4.4e-48

Best Hits

Swiss-Prot: 62% identical to MMCV_STRLA: Sulfate adenylyltransferase subunit 2 (mmcV) from Streptomyces lavendulae

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 100% identity to hse:Hsero_3102)

MetaCyc: 74% identical to sulfate adenylyltransferase small subunit (Allochromatium vinosum)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0N0 at UniProt or InterPro

Protein Sequence (311 amino acids)

>HSERO_RS15565 sulfate adenylyltransferase subunit 2 (Herbaspirillum seropedicae SmR1)
MNTAVDKLFLDNASNRHLDWLESEAIHIMREVAAECSTPALLFSGGKDSVVLLRIAEKAF
RPGKFPFPLVHIDTGHNFPEVIEFRDRRAAELGERLVVRSVEDSIKRGTVRLRNPQTDSR
NAAQAVTLLETIEEFKFDACIGGARRDEEKARAKERIFSFRDEFGQWNPKAQRPELWDLY
NTRVHPGENMRVFPISNWTELDVWQYIAREKLALPSIYFAHEREVIPRNGLLVPLTDLTP
AREGETVEKQVVRFRTVGDISCTCPVSSDAASVEAIIAETAVTQITERGATRMDDQTSEA
SMEKRKKEGYF