Protein Info for HSERO_RS15435 in Herbaspirillum seropedicae SmR1

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 12 to 261 (250 residues), 171.8 bits, E=1.7e-54
• PF16113: ECH_2
  • amino acids 15 to 218 (204 residues), 104.9 bits, E=6.6e-34

Best Hits

KEGG orthology group: K13766, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 100% identity to hse:Hsero_3076)

MetaCyc: 46% identical to 3-methylglutaconyl-CoA hydratase (Pseudomonas putida)
Methylglutaconyl-CoA hydratase. [EC: 4.2.1.18]

Predicted SEED Role

"Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" in subsystem Benzoate transport and degradation cluster or HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.2.1.18)

MetaCyc Pathways

• L-leucine degradation I (5/6 steps found)
• ferrichrome A biosynthesis (2/5 steps found)

KEGG Metabolic Maps

• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.18

Sequence Analysis Tools

See D8J0K8 at UniProt or InterPro

Protein Sequence (269 amino acids)

>HSERO_RS15435 enoyl-CoA hydratase (Herbaspirillum seropedicae SmR1)
MSSAAHLDITPRGLATITLNRPEIHNAFDDQLIAHLIDLLTQARDDTRTCLLLLASTGKS
FSAGADLAWMRRMADASREDNLRDARKLALLMETLNSFPTPTLAKVQGAVMGGGVGLVSC
CDIVVASDAAFFALSEVKLGLAPAAISPYVIAKMGVSQARRYFVSAERFPAARAAAMGLV
HEVAPPDELDARTAQLIDTLLANGPQAMRAAKQLVQVANPLQVTPELSEYTAGVIADLRA
SAEGREGLRAFLDKDAPAWTRQQPTSGAA