Protein Info for HSERO_RS15285 in Herbaspirillum seropedicae SmR1

Annotation: multidrug ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 698 transmembrane" amino acids 141 to 164 (24 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 395 to 418 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 142 to 402 (261 residues), 62.8 bits, see alignment E=6.5e-21 PF00005: ABC_tran" amino acids 479 to 623 (145 residues), 103.1 bits, see alignment E=3e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3046)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0H8 at UniProt or InterPro

Protein Sequence (698 amino acids)

>HSERO_RS15285 multidrug ABC transporter ATPase (Herbaspirillum seropedicae SmR1)
MSEISTSLSWALTMAARRQGVVIDTQRLGTAIAAAVGKGGSPDIPKLCRALNLSRPRHLA
KPDRPSLPLLCQVKEQGWGLLVDQRPDGRWDFLCHTGQSVVGDAEIVGGGYRLDFTEQGG
KKGQQGFERVFLDAIGEFRPVLIEIVVASVVMSIIALGASIFSMQVYDRVIPTHGVATLI
VLAIGVGLAILFELGMKFARSHIMDKVVSGLDAKLSQALYERLLAVRVDQLPGSVGSLAG
QLRGYEQIRSFYTSQTLFTLVDLPLGLLFVLVIALIASPWMALVPTVFGVVAILIGYLSN
RKVARLADKSAAASNLKTGLLVETVEGVETIKSGSGGWKFLSRWIDVSAESIRSDMAMRA
IGDHAGYIAATLQQLSYSTTVIIGAFLVINGQITMGALIACSILGGRILAPVAMIPGLMV
QRAHTKATLAGLEKIYALQTDQGSERQLTPDNLRGEFRIEEAKFTYAGSMLNAMTIDQLT
INAGERVAVLGPIGAGKSTILRLLSGLYRPQQGRILLDGLDMANINRLTLNQHIGYLQQD
HRLFVGSLRENLLIGLPDPGDDVLRQVMERTGLLRLVSSHPKGLDLPIQEGGRGLSGGQK
QLVAFTRLLLCQPNVFLLDEPTASMDEDLERHCLNVLNQEISGGRTLVVVTHKPAFLPMV
DRVIVVVGNRIVLDGPRDVILARLRGQQAPLPAVSAEA