Protein Info for HSERO_RS15280 in Herbaspirillum seropedicae SmR1

Annotation: secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF00529: CusB_dom_1" amino acids 32 to 334 (303 residues), 31.7 bits, see alignment E=3e-11 PF13533: Biotin_lipoyl_2" amino acids 50 to 97 (48 residues), 30.8 bits, see alignment 4.9e-11 PF00364: Biotin_lipoyl" amino acids 53 to 90 (38 residues), 22.9 bits, see alignment 1.5e-08 PF16576: HlyD_D23" amino acids 216 to 320 (105 residues), 48.8 bits, see alignment E=1.4e-16 PF13437: HlyD_3" amino acids 233 to 343 (111 residues), 71.3 bits, see alignment E=2.5e-23

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to hse:Hsero_3045)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0H7 at UniProt or InterPro

Protein Sequence (384 amino acids)

>HSERO_RS15280 secretion protein (Herbaspirillum seropedicae SmR1)
MNNEKNPLISAQWVLRLSMASVLVLLLWAAVSQIDQVTRAQGQVIAVSRTQSVQAPDGGP
VKQILVKEGEAVKQGQLLMVLEQDRVQTSLNDSRAKVAALRISLARLRAEVYGHPLNFEP
DLLDYKEYIANQKDLYVKRKILIDQDLASLQDMLGLANQELEMNKSLERTGDVGRADVLR
LQRNVADIRAQINNKRNKYFQEALVDMTKVQEDLNTQREQLEDRTQVLEHTELKAPADGV
VKNIKVTTIGGVVRSGDVVMEILPVDNLIVEAKVSTADSAYVKVGQAANVKLDAYDYSIY
GTLNGHVVYVSPDTLLDETRQGAMPYYRVHIALEEAVFKGRKADAIQVKPGMTATVEIKA
NTRTVLSFLTKPIAKTLQESMGER