Protein Info for HSERO_RS15200 in Herbaspirillum seropedicae SmR1

Annotation: malate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20656: MS_N
  • amino acids 9 to 70 (62 residues), 60.5 bits, E=1.4e-20
• TIGR01344: malate synthase A
  • amino acids 23 to 528 (506 residues), 760 bits, E=4.6e-233
• PF01274: MS_TIM-barrel
  • amino acids 160 to 405 (246 residues), 360.2 bits, E=6.3e-112
• PF20659: MS_C
  • amino acids 412 to 528 (117 residues), 136 bits, E=1.3e-43

Best Hits

Swiss-Prot: 59% identical to MASY_MYXXD: Malate synthase (mls) from Myxococcus xanthus (strain DK 1622)

KEGG orthology group: K01638, malate synthase [EC: 2.3.3.9] (inferred from 100% identity to hse:Hsero_3029)

MetaCyc: 50% identical to malate synthase (Arabidopsis thaliana col)
Malate synthase. [EC: 2.3.3.9]

Predicted SEED Role

"Malate synthase (EC 2.3.3.9)" in subsystem Photorespiration (oxidative C2 cycle) (EC 2.3.3.9)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• glycolate and glyoxylate degradation II (2/2 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• L-arabinose degradation IV (5/8 steps found)
• chitin deacetylation (2/4 steps found)
• D-xylose degradation IV (3/7 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (1/14 steps found)
• superpathway of pentose and pentitol degradation (19/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.9

Sequence Analysis Tools

See D8J0G1 at UniProt or InterPro

Protein Sequence (528 amino acids)

>HSERO_RS15200 malate synthase (Herbaspirillum seropedicae SmR1)
MTQLKLPTGMEISGDIKPGYENILTFEALSLVAKLSRAFEGRRQELLAARAERVKRLDAG
ERPDFLKETESIRTGDWKIAPIPEALKCRRVEITGPVERKMVINAFNSGADSYMTDFEDS
NSPVWDNQISGQINLYDAIRRTISLESNGKSYKLNDKIATLVVRPRGWHLDEKHVTLDGK
RISGGIFDFALFLFHNAKEQLARGAGPYFYLPKMESHLEARLWNDIFVMAQNEIGLPQGT
IKATVLIETITAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKNDKDFCLADRAKVT
MTSPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMQGIINDKRRDATDGY
DGGWVAHPGLVEASMKEFVAVLGDKPNQFEKQRPDVDVKAADLLNFQPETPITEAGLRYN
INVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRAQVWQWIRSAKGNLEDGRKVTADMVR
AMIPEELAKVKQVAGDGPTYDRAAKIFEEMSTSETFAEFLTLPLYEEI